DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstE11

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:225 Identity:89/225 - (39%)
Similarity:138/225 - (61%) Gaps:4/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVY 66
            :||.||||..|||.||.:|.|..:||:|:|:.|:....||.|.||:|||.||.||| :|.:|.:.
  Fly     3 AKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPV-LDDNGTIV 66

  Fly    67 VDSHAIVCFLVAKYA--GNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNP 129
            .|||.|..:|..|||  |:|.|||:|.::|..:|.|::|:.|.||..::.||...||.|.||...
  Fly    67 SDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPS 131

  Fly   130 RSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194
            ..:.....||..|||.|.:|.::||::|::||:|...::.|.:...|:|.:::|:..||::|: :
  Fly   132 DRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRI-Q 195

  Fly   195 LLPDNEEINLKGARALQTRILSCMAENKAK 224
            .||..::.|.:|...|...:...:||.:.|
  Fly   196 ALPYYQKNNQEGLDMLVGLVKGLLAERQQK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 37/73 (51%)
GST_C_Delta_Epsilon 92..211 CDD:198287 38/118 (32%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 80/194 (41%)
GST_N_Delta_Epsilon 5..78 CDD:239343 37/73 (51%)
GST_C_Delta_Epsilon 94..211 CDD:198287 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467997
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.