DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstE6

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:76/211 - (36%)
Similarity:122/211 - (57%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65
            |.|.|||....|||.||..|....:.|..|...||...:..||.|:::.||||.:|...| ||..
  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLED-DGHY 64

  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLF-QVVKDIVARNIYGGEGEYNP 129
            ..|||||:.:||:|||.:|.|||:|..:||.:|.|:|:|:||:| ..::.|....::.|:.:...
  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPK 129

  Fly   130 RSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194
            .........|..:|.||:...::.||:|::||.|:.:::.:|:..:.::..|||:...|::::::
  Fly   130 ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQ 194

  Fly   195 LLPDNEEINLKGARAL 210
             ||..||.|.||.|.|
  Fly   195 -LPYYEEANGKGVRQL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 92..211 CDD:198287 35/120 (29%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 65/193 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468007
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.