DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstE5

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:217 Identity:85/217 - (39%)
Similarity:126/217 - (58%) Gaps:3/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65
            |.|.|||....|||.||..|....:.|..|...|:.:.:|.||||::|.||:|.:|...| ||..
  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLED-DGNY 64

  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLF-QVVKDIVARNIYGGEGEYNP 129
            ..|||||:.:||:|||.:|.||||||.:||.:|.|:|:|.||:| ..:|.|.....:.|......
  Fly    65 IWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPK 129

  Fly   130 RSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194
            .........|..:|.||....::.|::|::||.|:.:::.:|...:.::|.|||:..:|:.|::|
  Fly   130 ERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEK 194

  Fly   195 LLPDNEEINLKGARALQTRILS 216
             ||..||.|.||||.|:|.:.|
  Fly   195 -LPYYEEANAKGARELETILKS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 31/73 (42%)
GST_C_Delta_Epsilon 92..211 CDD:198287 38/119 (32%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 71/193 (37%)
Thioredoxin_like 4..77 CDD:294274 31/73 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468005
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.