DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstE1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:198 Identity:71/198 - (35%)
Similarity:111/198 - (56%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||....||..|...|..|::.||.|.|.|:....||||||:||.||||.:|: :|.:|....|||
  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPM-LDDNGTFIWDSH 71

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLC 135
            ||..:||.|||.:|:|||:||.:||.::.|:.::..|::..:.::.......|..|.....|...
  Fly    72 AIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAV 136

  Fly   136 HNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPDNE 200
            |.....||.||....::.|:.|::||:|...|:..:...:.::...||:...|::|::| ||..:
  Fly   137 HQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNK-LPYYK 200

  Fly   201 EIN 203
            |||
  Fly   201 EIN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 33/71 (46%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/112 (25%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 33/71 (46%)
GstA 8..197 CDD:223698 66/190 (35%)
GST_C_Delta_Epsilon 94..210 CDD:198287 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468006
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.