DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstE10

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:218 Identity:85/218 - (38%)
Similarity:127/218 - (58%) Gaps:4/218 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65
            |:...||....|||.||.:|..:.:.||.|...:|....:||..:.::.||||.:|:..|.:..:
  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65

  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPR 130
            : |||||:.:||.|||.:|:|||:|..:||.:|.|:|:|.||||..:...:.|.::.......|:
  Fly    66 W-DSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK 129

  Fly   131 S-LTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDL-LIPVEREKYPQTKQWMERMD 193
            . |....:||:.||.||.:..:|.|.:|::||.||..|:.||.| ..||:..|||:...|:.|: 
  Fly   130 DRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARI- 193

  Fly   194 KLLPDNEEINLKGARALQTRILS 216
            ..||..||.||:|||.|..:|.|
  Fly   194 SALPFYEEDNLRGARLLADKIRS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 92..211 CDD:198287 46/120 (38%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 72/194 (37%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 91..211 CDD:198287 46/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467998
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.