DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstT1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:205 Identity:59/205 - (28%)
Similarity:105/205 - (51%) Gaps:17/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALF-SPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGE 64
            |||...||..| |.|:||..:..||.....|..||...|:|.|::|:..:|...::|..||...:
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYEN-------GVLFQVVKDIVARNIYG 122
            : .:|.:||.:|..|...::||||:.|:.||.:|..:.:::       .:.|:.|..:.|:.:..
  Fly    66 L-GESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP 129

  Fly   123 GEGEYNPRSL-TLCHNAYSD---LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLL-IPVEREKY 182
            ..   .|.|: .|..:..|:   ||....:..|:||::|:|||:...:.:..:.|. ..|..:::
  Fly   130 AP---KPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQF 191

  Fly   183 PQTKQWMERM 192
            |:..:||||:
  Fly   192 PKVAKWMERV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/74 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/113 (23%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/201 (28%)
GST_N_Theta 5..80 CDD:239348 24/75 (32%)
GST_C_Theta 93..218 CDD:198292 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.