DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and mars1

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_068077760.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:942 Species:Danio rerio


Alignment Length:77 Identity:21/77 - (27%)
Similarity:32/77 - (41%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LEHFL--QQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPDNEE--- 201
            ||..|  ::.||:....:|||||.:...|..|......|.......:.|.||:..:......   
Zfish   150 LEQSLSKRKASFLTDEVVSVADVVLWAALYPLLSDSAFEPGDLQAVRGWFERVCSVSACQSAALR 214

  Fly   202 -INLKGARALQT 212
             :..|||.||::
Zfish   215 VLQGKGAEALKS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 15/51 (29%)
mars1XP_068077760.1 GST_N_5 30..101 CDD:436537
GST_C_MetRS_N 104..205 CDD:198340 16/54 (30%)
PLN02610 279..917 CDD:215329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.