DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and clic1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:227 Identity:50/227 - (22%)
Similarity:85/227 - (37%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLV 77
            |.::...:|..|.|:...:..||..:|..:.::   |.|..| |.|:....||..|::.|..|| 
Zfish    25 PFSQRLFMVLWLKGVTFNVTTVDMKRKPEILKD---LAPGAQ-PPFLLYGTEVKTDTNKIEEFL- 84

  Fly    78 AKYAGNDQL----YPR-------------DL--KRRAHIDH-----RMHYENGVLFQVVK--DIV 116
                 .:.|    |||             |:  |..|:|.:     ..:.|.|:|..:.|  |.:
Zfish    85 -----EETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNLEKGLLKALKKLDDYL 144

  Fly   117 ARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLL------- 174
            :          :|....:..|:..|:  .....||:.|.||::||.::...|..:.::       
Zfish   145 S----------SPLPDEIDENSADDV--ISSTRSFLDGQELTLADCNLLPKLHIVKVVCLKFRGF 197

  Fly   175 -IP---VEREKYPQTKQWMERMDKLLPDNEEI 202
             ||   ....:|.......|......|.:|||
Zfish   198 SIPRSLTSLWRYLDAAYAREEFSSTCPSDEEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/129 (21%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 19/77 (25%)
O-ClC 6..241 CDD:129941 50/227 (22%)
GST_C_CLIC1 100..238 CDD:198333 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.