DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:63/180 - (35%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ACI----------LVAKLIGLDLELKPVDFAK-KEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||:          |:|:|..:.|::..||..| .......|...:|    |:.:| :|...:::.
  Fly    39 ACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILID-NGLAILENE 98

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARN--------IYGGEGEY 127
            .|...::....|...|:.:|.:....|::.  |....|..|.||....|        |.......
  Fly    99 KIERHIMKNIPGGYNLFVQDKEVATLIENL--YVKLKLMLVKKDEAKNNALLSHLRKINDHLSAR 161

  Fly   128 NPRSLT----LCHNA--YSDLEHFLQQGSFVVGNELSVADVSIHTTLVTL 171
            |.|.||    .|.:.  ...|:|....|.:.|       |..|.|.|..|
  Fly   162 NTRFLTGDTMCCFDCELMPRLQHIRVAGKYFV-------DFEIPTHLTAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 15/71 (21%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/94 (23%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 16/77 (21%)
O-ClC 21..231 CDD:129941 40/180 (22%)
GST_C_CLIC 118..232 CDD:198307 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.