DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstT4

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:236 Identity:56/236 - (23%)
Similarity:98/236 - (41%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKP-TLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEF-VKLNPQHQIPVFVDSDG 63
            ||:| ..|:...:..:||..::.:...:..|..|:...|.|||:.|| ..:|...::|...| .|
  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITD-HG 64

  Fly    64 EVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYEN---GV----LFQVVKDIV--ARN 119
            ....::.||...|..:....:..|||....|:.||..:.::.   ||    .|| .|.:|  .:.
  Fly    65 YQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ-QKWLVPYLQK 128

  Fly   120 IYGGEGEYNPRSLTLCH--NAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREK- 181
            ....:...|..|..|.|  |.:..|  ||....|::|:.:|.||:|         .:..:::.| 
  Fly   129 TRPADNAVNLASKQLEHTLNEFEQL--FLNSRKFMMGDNISYADLS---------AICEIDQPKS 182

  Fly   182 --------YPQTKQWMERM-DKLLPDNEEI------NLKGA 207
                    ..:..:|.|.: ::|.|..:|:      .|||:
  Fly   183 IGYNAFQNRNKLARWYETVREELGPHYKEVLGEFEAKLKGS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/75 (25%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/143 (22%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/75 (24%)
GST_C_Theta 95..220 CDD:198292 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.