DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:289 Identity:53/289 - (18%)
Similarity:87/289 - (30%) Gaps:122/289 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV--------YVD-------------- 68
            ||..|.:.|...:.||....|::||...::||.:..|..:        ||:              
  Rat    72 GLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPE 136

  Fly    69 ----SHAIV------------------CFLVAKYAGNDQLYPR---------------DLKRRAH 96
                .||.|                  |.|..:.. .|.:.|:               ||.:..|
  Rat   137 AGSPQHARVLQYRELLDALPMDAYTHGCILHPELT-TDSMIPKYATAEIRRHLANATTDLMKLDH 200

  Fly    97 IDHRM-----------------HYENG-----------VLFQVVKDIVARNIYGGEGEYNPRSLT 133
            .:.::                 |.:.|           ||.|:..::..|.:   |.|.....|.
  Rat   201 EEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKL---ENEGQTCELW 262

  Fly   134 LCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY------PQTKQWMERM 192
            ||                  |...::|||.:..||..|..|  ...:||      |..:.:.||:
  Rat   263 LC------------------GCAFTLADVLLGATLHRLKFL--GLSKKYWEDGSRPNLQSFFERV 307

  Fly   193 DKLLPDNEEINLKGARALQTRILSCMAEN 221
            .:.|...:.:.     .:.|.:||.:..|
  Rat   308 QRRLAFRKVLG-----DIHTTLLSAVIPN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/95 (20%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/152 (17%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 13/49 (27%)
GST_C_family 203..313 CDD:413470 25/132 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.