DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic6

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:178 Identity:44/178 - (24%)
Similarity:68/178 - (38%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKY----------- 80
            :||:.||.|..          .|.|... |.|:..||||..|.:.|..||..|.           
  Rat   418 VDLKRKPADLQ----------NLAPGTN-PPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQ 471

  Fly    81 ------AGND-----QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTL 134
                  ||||     ..:.::.|:    |....||..:| :.:|.:         ..|....|..
  Rat   472 HPESNSAGNDVFAKFSAFIKNTKK----DANDIYEKNLL-RALKKL---------DSYLNSPLPD 522

  Fly   135 CHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY 182
            ..:|||..:..:.|..|:.|:||::||.::...|    .:|.:..:||
  Rat   523 EIDAYSTEDVTVSQRKFLDGDELTLADCNLLPKL----HIIKIVAKKY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 44/178 (25%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 44/178 (25%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.