DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic4

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:193 Identity:36/193 - (18%)
Similarity:74/193 - (38%) Gaps:67/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVDFAK-----------------------KEHLSE-----EFVKLNPQHQIP 56
            :|..:..:||:.||.|...                       :|.|.|     :::||:|:|.  
Mouse    50 VVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHP-- 112

  Fly    57 VFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY 121
                       :|:.....:.||::.    |.::.:..|:    ...|.|:|..:.|        
Mouse   113 -----------ESNTAGMDIFAKFSA----YIKNSRPEAN----EALERGLLKTLQK-------- 150

  Fly   122 GGEGEY--NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY 182
              ..||  :|....:..|:..|::...::  |:.|:|:::||.::...|    .::.|..:||
Mouse   151 --LDEYLNSPLPDEIDENSMEDIKFSTRR--FLDGDEMTLADCNLLPKL----HIVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 14/85 (16%)
GST_C_Delta_Epsilon 92..211 CDD:198287 19/93 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 9/50 (18%)
O-ClC 17..252 CDD:129941 36/193 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.