DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:216 Identity:48/216 - (22%)
Similarity:87/216 - (40%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCF-- 75
            |..:...:|..|.|:...|..||..:...:.::|.   |..|:|:.: .||:|..|:..|..|  
  Rat    24 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILL-YDGDVKTDTLQIEEFLE 84

  Fly    76 ----------LVAKY-----AGNDQLYPRDLKRRAHIDHRMHYENGVLF-QVVKDIVARNIYGGE 124
                      |..:|     ||||..:    |..|.|.:.:..::..|: |:::.:...:.|.| 
  Rat    85 ETLGPPDFPGLAPRYRESNTAGNDIFH----KFSAFIKNPVPTQDDALYQQLLRALTRLDRYLG- 144

  Fly   125 GEYNPRSLTLCHNAYSDLEHFLQQ--------GSFVVGNELSVADVSIHTTLVTLDLLIPVEREK 181
                           :.|:|.|.|        ..|:.|::|::||.|:...|..:|.:....|::
  Rat   145 ---------------TPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQR 194

  Fly   182 -YPQTKQWMER-MDKLLPDNE 200
             .|.....:.| :|..|.:.|
  Rat   195 PIPAELSCVRRYLDSALQEKE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/76 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 25/120 (21%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.