Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350632.1 | Gene: | GSTZ1 / 2954 | HGNCID: | 4643 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 57/207 - (27%) |
---|---|---|---|
Similarity: | 93/207 - (44%) | Gaps: | 35/207 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KPTLY-YALFSPPARACILVAKLIGLDLELKPVDFAKK--EHLSEEFVKLNPQHQIPVFVDSDGE 64
Fly 65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGE----- 124
Fly 125 ---GEYNPRSLTLCHNA----YSDLEHFLQQ--GSFVVGNELSVADVSIHTTLVTLDLLIPVERE 180
Fly 181 KYPQTKQWMERM 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 27/76 (36%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 26/115 (23%) | ||
GSTZ1 | NP_001350632.1 | maiA | 8..212 | CDD:273527 | 55/205 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |