DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTZ1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:207 Identity:57/207 - (27%)
Similarity:93/207 - (44%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLY-YALFSPPARACILVAKLIGLDLELKPVDFAKK--EHLSEEFVKLNPQHQIPVFVDSDGE 64
            ||.|| |...|...|..|.:| |.|:|.|..|::..|.  :..|::|..|||..|:|. :..||.
Human     6 KPILYSYFRSSCSWRVRIALA-LKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPT-LKIDGI 68

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGE----- 124
            ....|.||:.:| .:.....:|.|:|.|:||.:            :::.|::|..|...:     
Human    69 TIHQSLAIIEYL-EEMRPTPRLLPQDPKKRASV------------RMISDLIAGGIQPLQNLSVL 120

  Fly   125 ---GEYNPRSLTLCHNA----YSDLEHFLQQ--GSFVVGNELSVADVSIHTTLVTLDLLIPVERE 180
               ||  ...||...||    ::.||..||.  |.:.||:|:::||:.:...:...: ...|:..
Human   121 KQVGE--EMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAE-RFKVDLT 182

  Fly   181 KYPQTKQWMERM 192
            .||......:|:
Human   183 PYPTISSINKRL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 27/76 (36%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/115 (23%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.