Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009651.1 | Gene: | Clic2 / 294141 | RGDID: | 1306580 | Length: | 245 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 44/202 - (21%) |
---|---|---|---|
Similarity: | 78/202 - (38%) | Gaps: | 73/202 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ELKPVDFAKKEHLSEE------FVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYP 88
Fly 89 RDLKRRAHIDHRMHYENGVL--FQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSF 151
Fly 152 VVGNELSVADVSIHTTLVTL--------DLLIPVE-------------REKYPQTKQWMERMDKL 195
Fly 196 LPDNEEI 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 14/53 (26%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 27/134 (20%) | ||
Clic2 | NP_001009651.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 1..96 | 8/18 (44%) | |
GST_N_CLIC | 9..99 | CDD:239359 | 8/21 (38%) | ||
O-ClC | 12..245 | CDD:129941 | 44/202 (22%) | ||
GST_C_CLIC2 | 106..244 | CDD:198331 | 34/160 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348058 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |