DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic2

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:202 Identity:44/202 - (21%)
Similarity:78/202 - (38%) Gaps:73/202 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELKPVDFAKKEHLSEE------FVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYP 88
            ||| .||.|.|...|:      :..|:|:             |.:|..:.|.|.||::.    |.
  Rat    78 ELK-TDFIKIEEFLEKTLAPPRYPHLSPK-------------YKESFDVGCNLFAKFSA----YI 124

  Fly    89 RDLKRRAHIDHRMHYENGVL--FQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSF 151
            ::.::.|:    .::|..:|  |:.:.|.:...:.   .|.:|.|..         |..|.:..|
  Rat   125 KNTQKEAN----KNFEKSLLREFKRLDDYLNTPLL---DEIDPDSTE---------ERTLSRRLF 173

  Fly   152 VVGNELSVADVSIHTTLVTL--------DLLIPVE-------------REKYPQTKQWMERMDKL 195
            :.|::|::||.|:...|..:        |..||.|             ||::..|          
  Rat   174 LDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHT---------- 228

  Fly   196 LPDNEEI 202
            .|:::||
  Rat   229 CPEDKEI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 41/190 (22%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 8/18 (44%)
O-ClC 12..245 CDD:129941 44/202 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:O15247 30..33
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.