DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:202 Identity:44/202 - (21%)
Similarity:78/202 - (38%) Gaps:73/202 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELKPVDFAKKEHLSEE------FVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYP 88
            ||| .||.|.|...|:      :..|:|:             |.:|..:.|.|.||::.    |.
  Rat    78 ELK-TDFIKIEEFLEKTLAPPRYPHLSPK-------------YKESFDVGCNLFAKFSA----YI 124

  Fly    89 RDLKRRAHIDHRMHYENGVL--FQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSF 151
            ::.::.|:    .::|..:|  |:.:.|.:...:.   .|.:|.|..         |..|.:..|
  Rat   125 KNTQKEAN----KNFEKSLLREFKRLDDYLNTPLL---DEIDPDSTE---------ERTLSRRLF 173

  Fly   152 VVGNELSVADVSIHTTLVTL--------DLLIPVE-------------REKYPQTKQWMERMDKL 195
            :.|::|::||.|:...|..:        |..||.|             ||::..|          
  Rat   174 LDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHT---------- 228

  Fly   196 LPDNEEI 202
            .|:::||
  Rat   229 CPEDKEI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 14/53 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/134 (20%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 8/18 (44%)
GST_N_CLIC 9..99 CDD:239359 8/21 (38%)
O-ClC 12..245 CDD:129941 44/202 (22%)
GST_C_CLIC2 106..244 CDD:198331 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.