DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTA4

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001503.1 Gene:GSTA4 / 2941 HGNCID:4629 Length:222 Species:Homo sapiens


Alignment Length:235 Identity:54/235 - (22%)
Similarity:101/235 - (42%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQ------------HQ 54
            ::|.|:|    |..|..:...:.:   |....|:|      .|||::...|            .|
Human     3 ARPKLHY----PNGRGRMESVRWV---LAAAGVEF------DEEFLETKEQLYKLQDGNHLLFQQ 54

  Fly    55 IPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARN 119
            :|: |:.||...|.:.:|:.::..|:    .|:.::||.|..||   .|..|.|  .:.:::..:
Human    55 VPM-VEIDGMKLVQTRSILHYIADKH----NLFGKNLKERTLID---MYVEGTL--DLLELLIMH 109

  Fly   120 IYGGEGEYNPRSLTLCHNA---YSDLEHFLQQG---SFVVGNELSVADVSIHTTLVTLDLLIP-- 176
            .:....:.....:.:...|   |..:...:.:|   ||:|||:||:|||.:..|::.|:..||  
Human   110 PFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNI 174

  Fly   177 -----------VEREKYPQTKQWMERMDKLLPDNEEINLK 205
                       |:....|..|:::|...|..|..:||.::
Human   175 LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVR 214

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/85 (22%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/133 (24%)
GSTA4NP_001503.1 Thioredoxin_like 4..82 CDD:412351 20/95 (21%)