Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741060.2 | Gene: | gst-34 / 260015 | WormBaseID: | WBGene00001782 | Length: | 218 | Species: | Caenorhabditis elegans |
Alignment Length: | 235 | Identity: | 51/235 - (21%) |
---|---|---|---|
Similarity: | 84/235 - (35%) | Gaps: | 84/235 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 FSPPARACILVAKLIGLDLE--LKPVDFAKKEHLSEEFVKL---NPQHQIPVFVDSDGEVYVDSH 70
Fly 71 AIVCFLVAK--YAGN------------DQ-----------LY------PRDLKRRAHIDHRMHYE 104
Fly 105 NGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLV 169
Fly 170 TLDLL--------IPVEREKY-------PQTKQWMERMDK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 22/71 (31%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 20/118 (17%) | ||
gst-34 | NP_741060.2 | GST_N_Sigma_like | 4..82 | CDD:239337 | 22/71 (31%) |
PTZ00057 | 6..213 | CDD:173353 | 50/231 (22%) | ||
GST_C_Sigma_like | 92..200 | CDD:198301 | 21/136 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |