DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-34

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:235 Identity:51/235 - (21%)
Similarity:84/235 - (35%) Gaps:84/235 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSPPARACILVAKLIGLDLE--LKPVDFAKKEHLSEEFVKL---NPQHQIPVFVDSDGEVYVDSH 70
            |:.|||   |:..|.|:..|  ..|.|.......|:.|:.|   .|..:.|| :..||.....|.
 Worm    14 FAEPAR---LLFHLGGVPYEDVRMPTDDIVPGIQSDAFLALKDKTPFGRFPV-LSIDGFDLAQST 74

  Fly    71 AIVCFLVAK--YAGN------------DQ-----------LY------PRDLKRRAHIDHRMHYE 104
            ||..:|..|  |||.            ||           ||      |.:..:|.|.:..:..:
 Worm    75 AIHRYLARKFGYAGKSPEDEAFADSIVDQVKEYLESFRPLLYAQKSGKPEEEVKRIHDEVYIPVK 139

  Fly   105 NGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLV 169
            | :||:::..|:..:                            :..::||:.|:.||:.:...|.
 Worm   140 N-LLFKILTRILKES----------------------------KSEYLVGDGLTWADLVVADHLY 175

  Fly   170 TLDLL--------IPVEREKY-------PQTKQWMERMDK 194
            :|..:        |.:..:||       |:.|.::|...|
 Worm   176 SLTNIKELDPEDPIHLNLKKYQERIFNLPELKDYIETRPK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 22/71 (31%)
GST_C_Delta_Epsilon 92..211 CDD:198287 20/118 (17%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 22/71 (31%)
PTZ00057 6..213 CDD:173353 50/231 (22%)
GST_C_Sigma_like 92..200 CDD:198301 21/136 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.