DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and CLIC4

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:230 Identity:41/230 - (17%)
Similarity:83/230 - (36%) Gaps:82/230 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVDFAK-----------------------KEHLSE-----EFVKLNPQHQIP 56
            :|..:..:||:.||.|...                       :|.|.|     :::||:|:|.  
Human    50 VVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHP-- 112

  Fly    57 VFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY 121
                       :|:.....:.||::.    |.::.:..|:    ...|.|:|..:.|        
Human   113 -----------ESNTAGMDIFAKFSA----YIKNSRPEAN----EALERGLLKTLQK-------- 150

  Fly   122 GGEGEY--NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY-- 182
              ..||  :|....:..|:..|::...::  |:.|||:::||.::...|    .::.|..:||  
Human   151 --LDEYLNSPLPDEIDENSMEDIKFSTRK--FLDGNEMTLADCNLLPKL----HIVKVVAKKYRN 207

  Fly   183 -----PQTKQW--------MERMDKLLPDNEEINL 204
                 ..|..|        .:......|.::|:.:
Human   208 FDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 39/216 (18%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 9/50 (18%)
O-ClC 17..252 CDD:129941 41/230 (18%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.