DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_594063.3 Gene:gst3 / 2543479 PomBaseID:SPAC688.04c Length:242 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:35/169 - (20%)
Similarity:66/169 - (39%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQ 110
            :.||:|..:.|:.|| ||..|::|.||:..||.||..:.:....|:......:..||:....|..
pombe    42 YTKLSPLGKSPIVVD-DGVTYIESAAILEHLVRKYGPSFKPSEEDVAELEKYELWMHFSEASLMP 105

  Fly   111 VV-----------------KDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELS 158
            .:                 :.||.:.:.|.:.:|..:. |..:..|  :::.|....:..|.:.:
pombe   106 FIWASHVLDLSVNMTPIFFRYIVRQFVNGIKSKYLSKE-TFLNLDY--IDNHLASNEYFAGEQFT 167

  Fly   159 VADVSIHTTLVTLDLLIPV--------EREKYPQTKQWM 189
            .||.         .:..|:        .::.|...|:||
pombe   168 AADP---------QMCFPIFAAQRDYLSQKPYKNIKRWM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 13/31 (42%)
GST_C_Delta_Epsilon 92..211 CDD:198287 18/123 (15%)
gst3NP_594063.3 GstA 1..218 CDD:223698 35/169 (21%)
GST_N_GTT1_like 2..76 CDD:239344 15/34 (44%)
GST_C_family 82..204 CDD:295467 19/128 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.