DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:222 Identity:52/222 - (23%)
Similarity:95/222 - (42%) Gaps:42/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65
            |::.||:.....|.....:...|.:.|..|.:.|:|:|.|..|.|.:.|||..::|..:|.....
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNND 65

  Fly    66 YV--DSHAIVCFLVAKYAGNDQLYPRDLKRRAHI--DHRMHYE--NGVLFQVVKDIVARNIYGGE 124
            |.  :|.||:.:|..||         |.:|:..:  ||..:|:  ..:.||.....:   |:|..
pombe    66 YTIWESDAILIYLADKY---------DTERKISLPRDHPEYYKVIQYLFFQASGQGI---IWGQA 118

  Fly   125 GEYNPRSLTLCHNAYSD-----------LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLL---- 174
            |.::.....|..:|.:.           ||..|:...::|.|..::||:|..:....|:::    
pombe   119 GWFSVYHQELVISAITRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEG 183

  Fly   175 -IPVERE--------KYPQTKQWMERM 192
             ..:|.|        ::|:|..|.:|:
pombe   184 KFSIEEEVPQLDFEKEFPRTYSWHQRL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/129 (20%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 24/89 (27%)
GstA 5..218 CDD:223698 51/218 (23%)
GST_C_Ure2p 96..219 CDD:198326 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.