Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659140.2 | Gene: | Gdap1l1 / 228858 | MGIID: | 2385163 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 208 | Identity: | 43/208 - (20%) |
---|---|---|---|
Similarity: | 78/208 - (37%) | Gaps: | 58/208 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV----- 65
Fly 66 ---YVD-----SHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYG 122
Fly 123 GEGEYNPRSLTLCHNAYSD---LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQ 184
Fly 185 -TKQWMERMDKLL 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 20/84 (24%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 18/109 (17%) | ||
Gdap1l1 | NP_659140.2 | GstA | 47..314 | CDD:223698 | 43/208 (21%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 18/69 (26%) | ||
GST_C_family | 201..311 | CDD:295467 | 4/15 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844809 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |