DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:208 Identity:43/208 - (20%)
Similarity:78/208 - (37%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV----- 65
            ||:...|..::...||....||..|.:.|...:.||....|::||...::||.:..|..:     
Mouse    49 LYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQ 113

  Fly    66 ---YVD-----SHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYG 122
               ||:     .|.:.   :...||:.| :.|.|:.|..:|                        
Mouse   114 IIDYVERTFTGEHVVA---LMPEAGSPQ-HARVLQYRELLD------------------------ 150

  Fly   123 GEGEYNPRSLTLCHNAYSD---LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQ 184
                      .|..:||:.   |...|...|.:  .:.:.|::..|....|.||: .::.|:.||
Mouse   151 ----------ALPMDAYTHGCILHPELTTDSMI--PKYATAEIRRHLANATTDLM-KLDHEEEPQ 202

  Fly   185 -TKQWMERMDKLL 196
             ::.::.:..||:
Mouse   203 LSEPYLSKQKKLM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 20/84 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 18/109 (17%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 43/208 (21%)
GST_N_GDAP1 47..119 CDD:239350 18/69 (26%)
GST_C_family 201..311 CDD:295467 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.