DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gstp3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:165 Identity:41/165 - (24%)
Similarity:68/165 - (41%) Gaps:30/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGV--LFQVVKDIV 116
            |||.|.|.:..:| .|:.|:..|...:.    ||.:|.:..|.:|   ...:|:  ||:.:....
Mouse   102 QIPKFQDGELTLY-QSNTILRHLGRS
FG----LYGKDQQEAALVD---MVNDGLEDLFRRIARQY 158

  Fly   117 ARNIYGGEGEYN---PRSLTLCHNAYSDLEHFLQQG----SFVVGNELSVADVSIHTTLVTLDLL 174
            ...:..|:.:|.   |..|       ...|..|.|.    ||:||:::|.||..:...|:.|:||
Mouse   159 RHILKEGKDQYQKELPGHL-------KPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLELL 216

  Fly   175 IPVEREKYPQTKQWMERMDK------LLPDNEEIN 203
            .|.....:|....::.|:..      .|...|.:|
Mouse   217 FPGYLNDFPLFSAYVARLKSRPKLKAFLESPEHVN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 9/23 (39%)
GST_C_Delta_Epsilon 92..211 CDD:198287 29/127 (23%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 9/24 (38%)
GST_C_family 134..253 CDD:383119 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.