DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic5

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:237 Identity:52/237 - (21%)
Similarity:84/237 - (35%) Gaps:81/237 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVD---FAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYA 81
            :|..:..:||:.||.|   .|...|              |.|:..:|:|..|.:.|..||     
Mouse   281 VVFNVTTVDLKRKPADLHNLAPGTH--------------PPFLTFNGDVKTDVNKIEEFL----- 326

  Fly    82 GNDQLYPRDLKRRAHIDHRMHYENGV-LFQ----VVKDIVARNIYGGEGEYNPRSLTLCHNAYSD 141
             .:.|.|....:.| ..||.....|: :|.    .:|:...:|....|     |.||   .|...
Mouse   327 -EETLTPEKYPKLA-AKHRESNTAGIDIFSKFSAYIKNTKQQNNAALE-----RGLT---KALRK 381

  Fly   142 LEHFL---------------QQGS---FVVGNELSVADVSIHTTLVTLDLL--------IPVERE 180
            |:.:|               ::||   |:.|:||::||.::...|..:.::        ||.|  
Mouse   382 LDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE-- 444

  Fly   181 KYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSCMAENK 222
               .|..|.             .||.|.|......:|.|:::
Mouse   445 ---MTGLWR-------------YLKNAYARDEFTNTCAADSE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 16/60 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/149 (21%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.