| Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
| Alignment Length: | 207 | Identity: | 41/207 - (19%) |
|---|---|---|---|
| Similarity: | 70/207 - (33%) | Gaps: | 85/207 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 KKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKR-RAHIDHRM 101
Fly 102 HYEN-----------------GVLFQVVKDIVARNIYGGEGEYNPRSL--------TL-----CH 136
Fly 137 NAYSDLEHFLQQGSF--------------------VVGNEL------SVADVSIHTTLVT----L 171
Fly 172 DLLIPVEREKYP 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 6/39 (15%) |
| GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 29/153 (19%) | ||
| Mars1 | NP_001165053.1 | Thioredoxin_like | 1..68 | CDD:294274 | |
| GstA | <47..189 | CDD:223698 | 28/134 (21%) | ||
| GST_C_MetRS_N | 77..179 | CDD:198340 | 26/123 (21%) | ||
| PRK12268 | 266..821 | CDD:237029 | |||
| MetRS_core | 267..635 | CDD:173907 | |||
| 'HIGH' region | 275..285 | ||||
| 'KMSKS' region | 595..599 | ||||
| Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
| MetRS_RNA | 855..899 | CDD:238475 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||