Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775370.1 | Gene: | eef1g / 195822 | ZFINID: | ZDB-GENE-020423-3 | Length: | 442 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 81/199 - (40%) | Gaps: | 20/199 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSKPTLYYALFSPPARA--CILVAKLIGLDLEL---KPVDFAKKEHLSEEFVKLNPQHQIPVFVD 60
Fly 61 SDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEG 125
Fly 126 EYNPRSLTLC----HNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTL--DLLIPVEREKYPQ 184
Fly 185 TKQW 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 19/78 (24%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 19/103 (18%) | ||
eef1g | NP_775370.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 21/84 (25%) |
maiA | 5..201 | CDD:273527 | 43/195 (22%) | ||
GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 19/102 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 227..273 | ||||
EF1G | 280..386 | CDD:279041 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |