DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and EEF1G

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens


Alignment Length:255 Identity:59/255 - (23%)
Similarity:101/255 - (39%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLEL--KPVDFAKKEHLSE-----EFVKLNPQHQIPVF 58
            |:..|||....:..|...::.|:..|..:.:  .|..|    |..:     ||::..|..::|.|
Human     1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHF----HFGQTNRTPEFLRKFPAGKVPAF 61

  Fly    59 VDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGG 123
            ...||....:|:||     |.|..|::|.....:..|.:...:.:.:       .|||.      
Human    62 EGDDGFCVFESNAI-----AYYVSNEELRGSTPEAAAQVVQWVSFAD-------SDIVP------ 108

  Fly   124 EGEYNPRS------LTLCH-------NAYSD-------LEHFLQQGSFVVGNELSVADVSIHTTL 168
                 |.|      |.:.|       ||..:       |:.:|:..:|:||..:::||:::..||
Human   109 -----PASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTL 168

  Fly   169 VTL--DLLIPVEREKYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSC--MAENKAK 224
            :.|  .:|.|..|:.:|.|.:|....         ||....||:...:..|  ||:..||
Human   169 LWLYKQVLEPSFRQAFPNTNRWFLTC---------INQPQFRAVLGEVKLCEKMAQFDAK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/80 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 30/140 (21%)
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 21/86 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/148 (21%)
tolA <212..>278 CDD:236545 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.