DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-43

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:229 Identity:57/229 - (24%)
Similarity:100/229 - (43%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVD-FAKKEHLSEEFVKLNPQHQIPVFVDSDGE 64
            |:||.||....|..|....:...|..:|.|.:|:| |:::...:.||||.||..::|..| .:|.
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLV-INGL 64

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDI---VARNIYGGEGE 126
            ...:|.||:.:|...|. :....|::|.:|:       |...:...:|..|   .|.||:....|
 Worm    65 SLTESLAIIEYLDEAYP-DPPFLPKELDKRS-------YSRAIALHIVASIQPLQAINIHKMLNE 121

  Fly   127 YNPRSLTLCHNAYSDL--EHFLQQ-------------GSFVVGNELSVADVSIHTTLVTLDLLIP 176
            ..|        .|.|.  .||:.:             |.:.||::|::||:::.:.:.... :..
 Worm   122 KEP--------GYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAK-IYK 177

  Fly   177 VEREKYPQTKQWMERMDKLL----------PDNE 200
            |:..|||.    :.|::::|          |||:
 Worm   178 VDMSKYPT----ITRINEILAEDFRFKLAHPDNQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/74 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/137 (20%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 23/73 (32%)
maiA 5..211 CDD:273527 54/225 (24%)
GST_C_Zeta 90..207 CDD:198300 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.