DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:206 Identity:50/206 - (24%)
Similarity:85/206 - (41%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVY 66
            :||.||.:..|..:........|..:|.|.:||:...|:. .:||...||..::|: :..:|...
 Worm     3 AKPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK-EQEFHGNNPAEKVPI-LKINGLTL 65

  Fly    67 VDSHAIVCFLVAKYAGNDQLYP--------RDLKRRAHIDHRMHYENGVLFQVVKDIVA---RNI 120
            .:|.||:.:|       |::||        .:||.||         ..:.|.:..:|..   :.|
 Worm    66 TESMAIIEYL-------DEIYPDPPLLPKEPELKARA---------RAIAFHIASNIQPLQNKPI 114

  Fly   121 Y-------GGEGEYNPRSLTLCHN----AYSDLEHFLQ--QGSFVVGNELSVADVSIHTTLVTLD 172
            |       .|.|::      .|.:    .:..||..||  .|.|.|||::|:||:.:.:.:....
 Worm   115 YLMLNEKEPGYGDF------WCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAI 173

  Fly   173 LLIPVEREKYP 183
            ....|:...||
 Worm   174 EKYHVDMTPYP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 25/108 (23%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 20/79 (25%)
maiA 18..211 CDD:273527 45/191 (24%)
GST_C_Zeta 89..207 CDD:198300 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163437
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.