DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-11

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_508625.1 Gene:gst-11 / 187817 WormBaseID:WBGene00001759 Length:203 Species:Caenorhabditis elegans


Alignment Length:43 Identity:12/43 - (27%)
Similarity:27/43 - (62%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 FVVGNELSVADVSI-HTTLVTLDLLIPVEREKYPQTKQWMERM 192
            :.||:::|.||::| |........::|....|||:.::::|::
 Worm   143 YFVGDKISYADLAIFHIFWFMNSKILPGALRKYPKLQEFIEKI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 12/41 (29%)
gst-11NP_508625.1 GST_N_Sigma_like 3..72 CDD:239337
GST_C_Sigma_like 82..185 CDD:198301 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.