DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-15

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:211 Identity:47/211 - (22%)
Similarity:88/211 - (41%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYAL--FSPPARACILVAKLIGLDLELKPVDF-AKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVD 68
            |:.|  ::.|||....::.....|:.:...|. .|.|.:.::    .|..|:|| ::.||.....
 Worm     8 YFDLRGWAEPARQLFHLSHTPYDDIRIPMADTEGKWEKMRDK----TPFGQLPV-LNVDGFDIPQ 67

  Fly    69 SHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGE------- 126
            |.||..:|..|:....:....:....|.:|....:  .|.|:.:  :.|......|.|       
 Worm    68 SAAICRYLAKKFGYAGKTPEEEAWADAVVDQFKDF--SVAFKTL--LFATRAGKPEEEILKIRYE 128

  Fly   127 -YNPRSLTLCHNAYSDLEHFL---QQGSFVVGNELSVADVSIHTTLVTLDLL--IPVEREKYPQT 185
             :||     ..:.|..|.:.:   .:..::||:.|:.||:.|...|.:|:.|  |..:.|.:...
 Worm   129 IFNP-----ARDVYFILLNRILKKSKSGYLVGDGLTWADLVIADNLHSLEKLRAIDDDDEGHQNL 188

  Fly   186 KQWMERMDKLLPDNEE 201
            |::.|::.. .||.|:
 Worm   189 KKYKEKIYG-TPDLED 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/73 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/123 (22%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 19/73 (26%)
PTZ00057 6..211 CDD:173353 47/211 (22%)
GST_C_Sigma_like 87..195 CDD:198301 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.