DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_501847.1 Gene:gst-2 / 177884 WormBaseID:WBGene00001750 Length:188 Species:Caenorhabditis elegans


Alignment Length:166 Identity:41/166 - (24%)
Similarity:69/166 - (41%) Gaps:31/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EEFVKLN---PQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYEN 105
            |||..|.   |..|:|| ::.||.:...|.:|..||..:|..:.:....:::..:.||       
 Worm    37 EEFKSLKSNLPSGQLPV-LEIDGVMISQSASIGRFLAR
QYGYSGKTPTEEMQVDSIID------- 93

  Fly   106 GVLFQVVKDIVAR------NIYGGEGEYNPRSL------TLCHNAYSDLEHFL--QQGSFVVGNE 156
              ||   ||.:..      .:..|..||....:      ....|.:..|...|  .:..|:||::
 Worm    94 --LF---KDFMLTFRQFFFAVIHGYPEYEKERMKRDIVKPAIKNYFIALNKILLRSKSGFLVGDD 153

  Fly   157 LSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERM 192
            |:.||:.|...|.|| :.|.:..||.|....::.::
 Worm   154 LTWADLQIADNLSTL-INIRLFAEKEPHLNVFIRKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 14/36 (39%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/115 (23%)
gst-2NP_501847.1 GST_N_Sigma_like 4..73 CDD:239337 14/36 (39%)
GST_C_Sigma_like 84..187 CDD:198301 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D510902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.