DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-40

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_499981.1 Gene:gst-40 / 176900 WormBaseID:WBGene00001788 Length:216 Species:Caenorhabditis elegans


Alignment Length:213 Identity:51/213 - (23%)
Similarity:80/213 - (37%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLE---LKPVDF--AKKEHLSEEFVKLNPQHQIPVFVDSD-GE 64
            |||......|....||...:|:|.|   :...||  |.|:..        |..|:| |::.| |:
 Worm    11 LYYVNMRGRAEPIRLVFHFLGVDFEDYRMDKGDFTGAMKDKA--------PMKQLP-FIEIDGGK 66

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKR-RAHIDHRMHYENGVLFQV----------VKDIVAR 118
            ..:.....:|..:||....|:.:....|. .|.:| .|......|||:          :||.:. 
 Worm    67 TTLCQTVSICRYLAKSIQPDRWFGGATKTDSAKVD-MMADGFADLFQLAAMAKYAPDPIKDSMM- 129

  Fly   119 NIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYP 183
                  |.|.........|....|:.  .:|.:.||..:...||.|...|..||.......:..|
 Worm   130 ------GTYKESIGPKLENMQDLLKK--SKGEYFVGKSIHWCDVYILGVLQALDESDDGVFDNLP 186

  Fly   184 QTKQWMERMDKLLPDNEE 201
            :.:::..|| :.||:.:|
 Worm   187 ELREYYLRM-RNLPELKE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 20/77 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/121 (23%)
gst-40NP_499981.1 GST_N_Sigma_like 9..81 CDD:239337 20/78 (26%)
PTZ00057 11..214 CDD:173353 51/213 (24%)
GST_C_Sigma_like 96..195 CDD:198301 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D510902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.