DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gst-27

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:62 Identity:19/62 - (30%)
Similarity:31/62 - (50%) Gaps:14/62 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QGSFVVGNELSVADVSIHTTLVTLD-----------LLIPVEREKY--PQTKQWME-RMDKL 195
            :..|:||:.|::||:.|...:.|||           .|:.:..:.|  |..|:|:| |.|.|
 Worm   147 KSGFLVGDGLTIADIVIVECITTLDKHQLFTASEQPKLVALREKVYAIPAIKKWVEIRPDTL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343
GST_C_Delta_Epsilon 92..211 CDD:198287 19/62 (31%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337
PTZ00057 6..208 CDD:173353 18/60 (30%)
GST_C_Sigma_like 85..191 CDD:198301 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.