powered by:
Protein Alignment GstE13 and gst-27
DIOPT Version :9
Sequence 1: | NP_001188889.1 |
Gene: | GstE13 / 35928 |
FlyBaseID: | FBgn0033381 |
Length: | 226 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497116.1 |
Gene: | gst-27 / 175166 |
WormBaseID: | WBGene00001775 |
Length: | 209 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 19/62 - (30%) |
Similarity: | 31/62 - (50%) |
Gaps: | 14/62 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 QGSFVVGNELSVADVSIHTTLVTLD-----------LLIPVEREKY--PQTKQWME-RMDKL 195
:..|:||:.|::||:.|...:.||| .|:.:..:.| |..|:|:| |.|.|
Worm 147 KSGFLVGDGLTIADIVIVECITTLDKHQLFTASEQPKLVALREKVYAIPAIKKWVEIRPDTL 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1231780at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X30 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.