DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gsto1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:194 Identity:47/194 - (24%)
Similarity:83/194 - (42%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            :|...|.|.|:..::|.|..|:..|:..::...|   .|.|.:.||...:||..:|.|.:..:| 
Mouse    26 VYSMRFCPFAQRTLMVLKAKGIRHEVININLKNK---PEWFFEKNPLGLVPVLENSQGHLVTES- 86

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLC 135
            .|.|..:.:.....:|:|.|..::|.  .:|..|:   |..|..::|..:.....|.:|......
Mouse    87 VITCEYLDEAYPEKKLFPDDPYKKAR--QKMTLES---FSKVPPLIASFVRSKRKEDSPNLREAL 146

  Fly   136 HNAYSDLEHFLQQ-GSFVVGNELSVADVSIHTTLVTLDLLIPVEREK----YPQTKQWMERMDK 194
            .|.:..||..:.. .||:.|:..|:.|   :.|......|..:|.::    .|:.|.||..|.:
Mouse   147 ENEFKKLEEGMDNYKSFLGGDSPSMVD---YLTWPWFQRLEALELKECLAHTPKLKLWMAAMQQ 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 92..211 CDD:198287 24/108 (22%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 20/71 (28%)
GstA 26..224 CDD:223698 47/194 (24%)