DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gstt2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:243 Identity:70/243 - (28%)
Similarity:114/243 - (46%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVD------SDGE 64
            ||..|.|.|:||..:.||..|:..:.:.||..|.:|:||:|.::|..:::||..|      ....
Mouse     5 LYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPS 69

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRM--HYEN-----GVLF--QVVKDIVARNI 120
            ..:.|.||:.:|.:||...|..||.||:.||.:...:  |.:|     |||.  :|:..::...:
Mouse    70 SMIPSTAILIYLSSKY
QVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQV 134

  Fly   121 YGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTL-DLLIPVER----- 179
            ...:.|.|...:.|......|  .||:..:|:||.::::||      |::| :|:.||..     
Mouse   135 PQEKVERNRDRMVLVLQQLED--KFLRDRAFLVGQQVTLAD------LMSLEELMQPVALGYNLF 191

  Fly   180 EKYPQTKQWMERMDKLLPDNEEINLKGARALQ---TRILSCMAENKAK 224
            |..||...|.||::..|         ||...|   :.|||.:.:...|
Mouse   192 EGRPQLTAWRERVEAFL---------GAELCQEAHSTILSILGQAAKK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 25/77 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/133 (25%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/79 (32%)
GST_C_Theta 98..223 CDD:198292 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.