DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gstt1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:219 Identity:64/219 - (29%)
Similarity:108/219 - (49%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||..|.|.|.||..:.||...:..::..|:..|.||||:.|.::||..::|..:|. |....:|.
Mouse     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG-GFTLCESV 68

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYEN-GVLFQVVKDI---VARNIYGGEGEYNPRS 131
            ||:.:|..||...|..||:||:.||.:|..:.::: |:....::.:   |...::.|| :..|.:
Mouse    69 AILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGE-QIPPET 132

  Fly   132 L--TLCH---NAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-----EKYPQTK 186
            |  ||..   |.....:.|||...|:||..:|:||:     :...:|:.||..     |.:|:..
Mouse   133 LAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADL-----VAITELMHPVGGGCPVFEGHPRLA 192

  Fly   187 QWMERMD-----KLLPDNEEINLK 205
            .|.:|::     .|..:..|:.||
Mouse   193 AWYQRVEAAVGKDLFREAHEVILK 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/133 (24%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 61/213 (29%)
GST_N_Theta 3..78 CDD:239348 25/73 (34%)