DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gdap1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_034397.1 Gene:Gdap1 / 14545 MGIID:1338002 Length:358 Species:Mus musculus


Alignment Length:216 Identity:44/216 - (20%)
Similarity:81/216 - (37%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||:...|..::...||.....|..|...|.....||....|::||...::||.|..: .:..::.
Mouse    28 LYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGE-NIICEAT 91

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGE-YNPRSLTL 134
            .|:.:|...:.  |:..||                              :...||. |.||   :
Mouse    92 QIIDYLE
QTFL--DERTPR------------------------------LMPDEGSMYYPR---V 121

  Fly   135 CHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVE-----REKYPQTKQWMERMDK 194
            .|  |.:|...|...::..|       ..:|..| |:|.:||..     |.:...|:..::::.:
Mouse   122 QH--YRELLDSLPMDAYTHG-------CILHPEL-TVDSMIPAYATTRIRSQIGNTESELKKLAE 176

  Fly   195 LLPDNEEINLKGARALQTRIL 215
            ..||.:|..:...:.|::::|
Mouse   177 ENPDLQEAYIAKQKRLKSKLL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 92..211 CDD:198287 21/124 (17%)
Gdap1NP_034397.1 GST_N_GDAP1 26..98 CDD:239350 17/70 (24%)
GST_C_GDAP1 179..289 CDD:198336 5/19 (26%)
Required for mitochondrial localization. /evidence=ECO:0000250 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.