Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_254279.1 | Gene: | Clic1 / 114584 | MGIID: | 2148924 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 248 | Identity: | 55/248 - (22%) |
---|---|---|---|
Similarity: | 88/248 - (35%) | Gaps: | 80/248 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFL- 76
Fly 77 -------------------------VAKYAG---------NDQLYPRDLKRRAHIDHRMHYENGV 107
Fly 108 LFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLD 172
Fly 173 LLIPVER-----------EKYPQTKQWMERMDKLLPDNEEINL---KGARALQ 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 19/90 (21%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 29/132 (22%) | ||
Clic1 | NP_254279.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..90 | 19/68 (28%) | |
O-ClC | 6..241 | CDD:129941 | 54/246 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844823 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |