DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and LOC100911464

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_038967329.1 Gene:LOC100911464 / 100911464 RGDID:6492721 Length:249 Species:Rattus norvegicus


Alignment Length:180 Identity:42/180 - (23%)
Similarity:69/180 - (38%) Gaps:60/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QIPVFVDSDGEVYVDSHAIVCFLVAKYAGND-QLYPRDLKRRAHID------HRMH--------- 102
            |:|.|.|.|..:|..|      .:.::.|:. .||.:..:..|.:|      ..:|         
  Rat   101 QLPKFEDGDLTLYQSS------AILRHVG
HSFGLYGKGQREAALVDMVNDGVEDLHYRYVTLIYT 159

  Fly   103 -YENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQG-SFVVGNELSVADVSIH 165
             ||||      ||...:.:   .|...|....|..|         |:| :|:||:::|.|:.:: 
  Rat   160 IYENG------KDDYMKAL---PGHLKPFETLLSQN---------QEGKAFIVGDQISFANYNL- 205

  Fly   166 TTLVTLDLLI---------PVEREKYPQTKQWMERMDKLLPDNEEINLKG 206
                 ||||:         .|.....|:.|.::...:.:   |..||.||
  Rat   206 -----LDLLLVHFPLLAAYVVHLSAQPKIKAFLSSSNDV---NRPINDKG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 7/23 (30%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/141 (23%)
LOC100911464XP_038967329.1 Thioredoxin_like <96..123 CDD:412351 7/27 (26%)
GST_C_family 133..249 CDD:413470 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.