DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and LOC100496158

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_012818939.2 Gene:LOC100496158 / 100496158 -ID:- Length:247 Species:Xenopus tropicalis


Alignment Length:208 Identity:54/208 - (25%)
Similarity:90/208 - (43%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQ--HQIPVFVDSDGEV 65
            ||.|||  |:...|...:...|....:|.:.|...|:|.. |:.:|....  .|:|: |:.||..
 Frog    31 KPVLYY--FNGRGRMESIRWLLGAAGIEFEEVYLEKREQY-EQLIKEGRLMFGQVPL-VEMDGMN 91

  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDI----VARNIYGGEGE 126
            ...:|.|:.::.|||    .||.:|.|.|..||   .|.:|.:     |:    :|.......|:
 Frog    92 LTQTHPILSYIAAKY----NLYGKDPKERYEID---RYADGTI-----DLMGLGLAYPFLDDAGK 144

  Fly   127 YNPRSL--TLCHNAYSDL-EHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER------EKY 182
            ...:.|  ....|.|..: |..|:...::|||:.|.||:.:      ::.::.||.      ..:
 Frog   145 EKQKGLIKERATNKYFPVYETALKDKDYLVGNKFSWADIQL------MEAILMVEEFHSDILSCF 203

  Fly   183 PQTKQWMERMDKL 195
            ||.:.:.||..|:
 Frog   204 PQLQAFKERTKKM 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 20/75 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/117 (23%)
LOC100496158XP_012818939.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D510902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.