DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and eef1e1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:143 Identity:31/143 - (21%)
Similarity:55/143 - (38%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVAR 118
            :|||...:.|...|....|...|| |.|..::|.....:.:|.:...:.|....:.:.......|
 Frog    29 KIPVLQTNKGPSLVGLSTIASHLV-KEAKKEELLGSTAEEKAIVQQWLEYRISYIDRASSKEDIR 92

  Fly   119 NIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADV----SIHTTLVTLDLLIPVER 179
            |:                  .:||.|:|:...||.||.:::||:    .:|..:..|.:   .|:
 Frog    93 NV------------------LNDLNHYLKDKVFVAGNTVTLADILIYYGLHPVITGLSV---QEK 136

  Fly   180 EKYPQTKQWMERM 192
            |.|....:|...:
 Frog   137 ETYINVSRWFSHI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 7/23 (30%)
GST_C_Delta_Epsilon 92..211 CDD:198287 20/105 (19%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.