DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)2-10 and ZMIZ2

DIOPT Version :9

Sequence 1:NP_724749.1 Gene:Su(var)2-10 / 35927 FlyBaseID:FBgn0003612 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_005249923.1 Gene:ZMIZ2 / 83637 HGNCID:22229 Length:929 Species:Homo sapiens


Alignment Length:664 Identity:164/664 - (24%)
Similarity:242/664 - (36%) Gaps:198/664 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YAQSVQEQNATLQYID-------PTRMYSHIQLPPTVQ---------PNPVGL------VGSGQG 140
            |.|..|...:|.|:..       |:..|...:||  :|         |.|.||      ..:|||
Human   278 YLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHRLP--LQQGMTQSLSVPGPTGLHYKPTEQFNGQG 340

  Fly   141 VQVPGGQMNVVGGAPFLH--THSI----NSQLPIHPDVRLKKLAFYDVLGTLIKPSTLVPRNTQR 199
            ....||.::.  ..|.|.  |.||    :|.||.:|...:             .||:.||..:..
Human   341 ASFNGGSVSY--SQPGLSGPTRSIPGYPSSPLPGNPTPPM-------------TPSSSVPYMSPN 390

  Fly   200 VQEV--PFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLVETS--CDQ------------ 248
             |||  ||...|.|        |.:..:||...|:     ::.|:..|  ||:            
Human   391 -QEVKSPFLPDLKP--------NLNSLHSSPSAHS-----QWPLLPGSGPCDELRLTFPVRDGVV 441

  Fly   249 EDCFPPNVNVKVNNKLCQL-----------PNV-------------IPTNRP-------NVEPKR 282
            .:.|....|:.|:|.:.||           |::             :.||.|       |..|..
Human   442 LEPFRLQHNLAVSNHVFQLRDSVYKTLIMRPDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLT 506

  Fly   283 PPRPVNVTSNVKL------SP---TVTNTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKTKG 338
            ..|..|.||:..|      .|   |:..|:|...|     |:...:.||.:.:...:||.:..|.
Human   507 IERGDNKTSHKPLYLKHVCQPGRNTIQITVTACCC-----SHLFVLQLVHRPSVRSVLQGLLKKR 566

  Fly   339 VKPADYTRGLIKEKLT------------EDADCEIATTMLKVSLNCPLGKMKMLLPCRASTCSHL 391
            :.||::....||...:            ||.   :..|.:||||.||:...::.||.|...|.|:
Human   567 LLPAEHCITKIKRNFSSGTIPGTPGPNGEDG---VEQTAIKVSLKCPITFRRIQLPARGHDCRHI 628

  Fly   392 QCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTP 456
            ||||...|||:|..:.||.||||:|.|:.:.|.:|.|...:| ..:..||..||.:....||...
Human   629 QCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMLGIL-IYIQNSDYEEITIDPTCSWKPV 692

  Fly   457 GLRSETQILDTPSKPAQKVEVISDDIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLTLSDSD 521
            .::.:..|.:.|..||.|                 ..|.:|||....|:      .:::..:...
Human   693 PVKPDMHIKEEPDGPALK-----------------RCRTVSPAHVLMPS------VMEMIAALGP 734

  Fly   522 DDMPLAKRRPPAKQAVASSTSNGS---GGGQ---------------RAYTPAQQP--QQSESPEQ 566
            ...|.|..:||:..|.:.....||   |.|.               ..:||...|  .||:.|  
Human   735 GAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIP-- 797

  Fly   567 QASRQSPEKQTVS-EQQLQQQQH----EQPATAAVHASLLESLAAAVADQKHFQLLDLAAVAAAA 626
             :|..:.||.|.. ..|:....|    ..|.|..:|.|   :|.|....|.|..       ....
Human   798 -SSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTS---NLGAPPGPQLHHS-------NPPP 851

  Fly   627 AATASSGQSQNAGP 640
            |:..|.||: :.||
Human   852 ASRQSLGQA-SLGP 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)2-10NP_724749.1 SAP 49..83 CDD:128789
PINIT 171..307 CDD:291022 40/191 (21%)
zf-MIZ 368..417 CDD:280964 24/48 (50%)
ZMIZ2XP_005249923.1 zf-MIZ 605..653 CDD:280964 24/47 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3884
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.