DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBM39

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:82 Identity:30/82 - (36%)
Similarity:45/82 - (54%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALA 129
            ||.|      |:|.|:|....||.::..|..:|.|::|.|.:|..||.||||..:.:...:.|..
Human   248 GPMR------LYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKK 306

  Fly   130 AKEALNGAEIMGQTIQV 146
            |.|.|||.|:.|:.::|
Human   307 ALEQLNGFELAGRPMKV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 5/14 (36%)
RRM_RBM8 67..154 CDD:409762 28/80 (35%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 30/82 (37%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406 12/33 (36%)
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355 12/33 (36%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.