| Sequence 1: | NP_610454.2 | Gene: | tsu / 35924 | FlyBaseID: | FBgn0033378 | Length: | 165 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_149105.3 | Gene: | ZCRB1 / 85437 | HGNCID: | 29620 | Length: | 217 | Species: | Homo sapiens |
| Alignment Length: | 137 | Identity: | 25/137 - (18%) |
|---|---|---|---|
| Similarity: | 51/137 - (37%) | Gaps: | 41/137 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 PQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAA 130
Fly 131 KEALNGAEIMGQTIQV---------------------DWCFVKG---------PKRV-------K 158
Fly 159 KSEKRRR 165 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tsu | NP_610454.2 | PBP2_NikA_DppA_OppA_like | 10..>80 | CDD:445520 | 3/13 (23%) |
| RRM_RBM8 | 67..154 | CDD:409762 | 18/116 (16%) | ||
| ZCRB1 | NP_149105.3 | RRM_ZCRB1 | 9..84 | CDD:409827 | 16/78 (21%) |
| PTZ00368 | <97..123 | CDD:173561 | 3/25 (12%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..217 | 6/20 (30%) |