DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and NIFK

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_115766.3 Gene:NIFK / 84365 HGNCID:17838 Length:293 Species:Homo sapiens


Alignment Length:156 Identity:33/156 - (21%)
Similarity:64/156 - (41%) Gaps:38/156 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQR 68
            :|.::..|:.|..::    :.:::::...||                       ..::|.||   
Human    11 ILSLNPQEDVEFQKE----VAQVRKRITQRK-----------------------KQEQLTPG--- 45

  Fly    69 SVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEA 133
                 :::|..:.....|.:|...|..:|.:....|:..:|||.|||||.||:|:...|....|.
Human    46 -----VVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAET 105

  Fly   134 LNGAEIMGQTIQVDWCFVKGPKRVKK 159
            :|. .:.|:.:..  |....|::|.|
Human   106 MNN-YLFGERLLE--CHFMPPEKVHK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 8/69 (12%)
RRM_RBM8 67..154 CDD:409762 22/86 (26%)
NIFKNP_115766.3 half-pint 2..>151 CDD:130706 33/156 (21%)
RRM_NIFK_like 46..119 CDD:409748 21/75 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..239
Interaction with MKI67 226..269
hNIFK_binding 227..266 CDD:463489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..293
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.