DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and AT1G60000

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:81 Identity:23/81 - (28%)
Similarity:41/81 - (50%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139
            |||.::......:.:...|.:.|::....:..|..||.|:||..|.|.:..:...|.|:|:|.|:
plant   179 LFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFEL 243

  Fly   140 MGQTIQVDWCFVKGPK 155
            .|:.|:|:  ..:|.|
plant   244 EGRAIRVN--LAQGKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 21/78 (27%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:473069
RRM 178..257 CDD:440488 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.