DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and UBP1A

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_849806.1 Gene:UBP1A / 841846 AraportID:AT1G54080 Length:430 Species:Arabidopsis thaliana


Alignment Length:108 Identity:30/108 - (27%)
Similarity:45/108 - (41%) Gaps:23/108 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELEPGPQ------------RSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHL-NLDRRTGF 112
            ::||.|.            |||     :..:||.:..|..:||.|...|.|::..| ..|:    
plant    44 QMEPLPSGNLPPGFDPTTCRSV-----YAGNIHTQVTEILLQEIFASTGPIESCKLIRKDK---- 99

  Fly   113 SKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPK 155
             ..|..|.|...:.|..|...|||..|.||.::|:|.:..|.:
plant   100 -SSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWAYATGQR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 6/30 (20%)
RRM_RBM8 67..154 CDD:409762 26/99 (26%)
UBP1ANP_849806.1 RRM1_PUB1 65..135 CDD:410026 23/79 (29%)
RRM2_PUB1 147..230 CDD:410031
RRM_SF 273..349 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.