DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and Y14

DIOPT Version :9

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:199 Identity:79/199 - (39%)
Similarity:111/199 - (55%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADVLDIDNAEEFEVDEDGD----------QGIVRLK--------EKAKHRKGRGF----GSDSNT 44
            ::.:|.:..|:..:||:|.          .|..|||        |.||..|||||    .||...
plant     6 SEAVDFEPEEDDLMDEEGTAIDGADVSPRAGHPRLKSAIAGANGESAKKTKGRGFREEKDSDRQR 70

  Fly    45 REAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRR 109
            |.:...:|.:.::.    .|||||||||||:.|:.:|||.||::|...|.|:|||||::||||||
plant    71 RLSSRDFESLGSDG----RPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRR 131

  Fly   110 TGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPK-------------RVKKSE 161
            :|:.|||||:|||..::|.:|..|:||||::.|.:.|||.|..||.             |.::|.
plant   132 SGYVKGYALIEYEKKEEAQSAISAMNGAELLTQNVSVDWAFSSGPSGGESYRRKNSRYGRSQRSR 196

  Fly   162 KRRR 165
            ..||
plant   197 SPRR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:413028 32/91 (35%)
RRM_RBM8 67..154 CDD:409762 49/86 (57%)
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 49/86 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2863
eggNOG 1 0.900 - - E1_KOG0130
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3744
Inparanoid 1 1.050 136 1.000 Inparanoid score I1825
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004710
OrthoInspector 1 1.000 - - oto3583
orthoMCL 1 0.900 - - OOG6_102283
Panther 1 1.100 - - LDO PTHR45894
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3311
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.820

Return to query results.
Submit another query.