DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsu and RBP47C

DIOPT Version :10

Sequence 1:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:83 Identity:20/83 - (24%)
Similarity:42/83 - (50%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAA 130
            |:..:....:||..:.....::::::.|.::|||.::.:.:.:..||      |::.....|..|
plant   297 PEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGF------VQFVNRPNAEEA 355

  Fly   131 KEALNGAEIMGQTIQVDW 148
            .|.|||..|..||:::.|
plant   356 LEKLNGTVIGKQTVRLSW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/13 (23%)
RRM_RBM8 67..154 CDD:409762 19/82 (23%)
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780
RRM2_SECp43_like 196..275 CDD:409781
RRM3_NGR1_NAM8_like 303..374 CDD:409782 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.